NUP50 anticorps (C-Term)

N° du produit ABIN631630

Cet anticorps Lapin Polyclonal détecte spécifiquement NUP50 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour NUP50 anticorps (C-Term) (ABIN631630)

Antigène: NUP50 (Nucleoporin 50kDa (NUP50))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP50 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NUP50 anticorps

Épitope: C-Term

Specificité: NUP50 antibody was raised against the C terminal of NUP50

Purification: Affinity purified

Immunogène: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP50 Blocking Peptide, (ABIN5615087), is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP50

Antigène: NUP50 (Nucleoporin 50kDa (NUP50))

Autre désignation: NUP50

Sujet: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Tube Formation